Recombinant Human BCDIN3D Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BCDIN3D-3359H |
Product Overview : | BCDIN3D MS Standard C13 and N15-labeled recombinant protein (NP_859059) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an RNA methyltransferase which belongs to the rossmann fold methyltransferase family, and serves as a 5'-methylphosphate capping enzyme that is specific for cytoplasmic histidyl tRNA. The encoded protein contains an S-adenosylmethionine binding domain and uses the methyl group donor, S-adenosylmethionine. This gene is overexpressed in breast cancer cells, and is related to the tumorigenic phenotype and poor prognosis of breast cancer. The encoded protein is thought to promote the cellular invasion of breast cancer cells, by downregulating the expression of tumor suppressor miRNAs through the dimethylation of the 5-monophosphate of the corresponding precursor miRNAs. |
Molecular Mass : | 33.2 kDa |
AA Sequence : | MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BCDIN3D BCDIN3 domain containing [ Homo sapiens (human) ] |
Official Symbol | BCDIN3D |
Synonyms | BCDIN3D; BCDIN3 domain containing; RNA 5'-monophosphate methyltransferase; BCDIN3 domain containing RNA methyltransfease; BCDIN3 domain-containing protein; pre-miRNA 5'-monophosphate methyltransferase; probable methyltransferase BCDIN3D; EC 2.1.1.- |
Gene ID | 144233 |
mRNA Refseq | NM_181708 |
Protein Refseq | NP_859059 |
UniProt ID | Q7Z5W3 |
◆ Recombinant Proteins | ||
BCDIN3D-10172H | Recombinant Human BCDIN3D, GST-tagged | +Inquiry |
BCDIN3D-1611HF | Recombinant Full Length Human BCDIN3D Protein, GST-tagged | +Inquiry |
BCDIN3D-7209H | Recombinant Human BCDIN3 Domain Containing, His-tagged | +Inquiry |
BCDIN3D-2329M | Recombinant Mouse BCDIN3D Protein | +Inquiry |
Bcdin3d-1846M | Recombinant Mouse Bcdin3d Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCDIN3D-8494HCL | Recombinant Human BCDIN3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCDIN3D Products
Required fields are marked with *
My Review for All BCDIN3D Products
Required fields are marked with *