Recombinant Human BCL2L2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BCL2L2-5179H
Product Overview : BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene.
Molecular Mass : 20.8 kDa
AA Sequence : MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BCL2L2 BCL2-like 2 [ Homo sapiens (human) ]
Official Symbol BCL2L2
Synonyms BCL2L2; BCL2-like 2; bcl-2-like protein 2; BCL W; KIAA0271; PPP1R51; protein phosphatase 1; regulatory subunit 51; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51; BCLW; BCL-W; BCL2-L-2;
Gene ID 599
mRNA Refseq NM_004050
Protein Refseq NP_004041
MIM 601931
UniProt ID Q92843

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2L2 Products

Required fields are marked with *

My Review for All BCL2L2 Products

Required fields are marked with *

0
cart-icon