Recombinant Human BCL2L2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BCL2L2-5179H |
Product Overview : | BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BCL2L2 BCL2-like 2 [ Homo sapiens (human) ] |
Official Symbol | BCL2L2 |
Synonyms | BCL2L2; BCL2-like 2; bcl-2-like protein 2; BCL W; KIAA0271; PPP1R51; protein phosphatase 1; regulatory subunit 51; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51; BCLW; BCL-W; BCL2-L-2; |
Gene ID | 599 |
mRNA Refseq | NM_004050 |
Protein Refseq | NP_004041 |
MIM | 601931 |
UniProt ID | Q92843 |
◆ Recombinant Proteins | ||
BCL2L2-26736TH | Recombinant Human BCL2L2, His-tagged | +Inquiry |
BCL2L2-2349M | Recombinant Mouse BCL2L2 Protein | +Inquiry |
BCL2L2-0373H | Recombinant Human BCL2L2 Protein (Ala2-Thr172), C-His-tagged | +Inquiry |
BCL2L2-4640H | Recombinant Human BCL2L2 protein, His-SUMO-tagged | +Inquiry |
BCL2L2-1588H | Recombinant Human BCL2L2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L2-8482HCL | Recombinant Human BCL2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L2 Products
Required fields are marked with *
My Review for All BCL2L2 Products
Required fields are marked with *
0
Inquiry Basket