Recombinant Human BCMO1 Protein, GST-tagged
Cat.No. : | BCMO1-171H |
Product Overview : | Human BCMO1 partial ORF ( NP_059125.2, 254 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTGAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCMO1 beta-carotene 15,15-monooxygenase 1 [ Homo sapiens ] |
Official Symbol | BCMO1 |
Synonyms | BCMO1; beta-carotene 15,15-monooxygenase 1; BCDO, BCDO1, beta carotene 15, 15 dioxygenase 1; beta,beta-carotene 15,15-monooxygenase; BCMO; FLJ10730; beta-carotene dioxygenase 1; beta-carotene 15, 15-dioxygenase 1; BCO; BCDO; BCO1; BCDO1; |
Gene ID | 53630 |
mRNA Refseq | NM_017429 |
Protein Refseq | NP_059125 |
MIM | 605748 |
UniProt ID | Q9HAY6 |
◆ Recombinant Proteins | ||
BCMO1-1554HF | Recombinant Full Length Human BCMO1 Protein, GST-tagged | +Inquiry |
BCMO1-26H | Recombinant Human BCMO1 protein, MYC/DDK-tagged | +Inquiry |
BCMO1-171H | Recombinant Human BCMO1 Protein, GST-tagged | +Inquiry |
BCMO1-170H | Recombinant Human BCMO1 Protein, GST-tagged | +Inquiry |
BCMO1-962R | Recombinant Rat BCMO1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCMO1-8474HCL | Recombinant Human BCMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCMO1 Products
Required fields are marked with *
My Review for All BCMO1 Products
Required fields are marked with *