Recombinant Human BCO2 Protein, GST-tagged

Cat.No. : BCO2-173H
Product Overview : Human BCO2 full-length ORF (BAB55379.1, 1 a.a. - 539 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BCDO2 catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism (Kiefer et al., 2001 [PubMed 11278918]).[supplied by OMIM
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 87.2 kDa
AA Sequence : MGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPDGTAYNMGNSFGPYGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFIPI
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCO2 beta-carotene oxygenase 2 [ Homo sapiens ]
Official Symbol BCO2
Synonyms BCO2; beta-carotene oxygenase 2; BCDO2, beta carotene dioxygenase 2; beta,beta-carotene 9,10-oxygenase; B DIOX II; beta carotene 9; 10 oxygenase; FLJ34464; beta-carotene dioxygenase 2; beta-carotene 9,10 oxygenase; b,b-carotene-9,10-dioxygenase; beta,beta-carotene 9,10-dioxygenase variant 1; BCDO2; B-DIOX-II;
Gene ID 83875
mRNA Refseq NM_001037290
Protein Refseq NP_001032367
MIM 611740
UniProt ID Q9BYV7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCO2 Products

Required fields are marked with *

My Review for All BCO2 Products

Required fields are marked with *

0
cart-icon
0
compare icon