Recombinant Human BCO2 Protein, GST-tagged
| Cat.No. : | BCO2-173H |
| Product Overview : | Human BCO2 full-length ORF (BAB55379.1, 1 a.a. - 539 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | BCDO2 catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism (Kiefer et al., 2001 [PubMed 11278918]).[supplied by OMIM |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 87.2 kDa |
| AA Sequence : | MGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDPDGTAYNMGNSFGPYGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFIPI |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCO2 beta-carotene oxygenase 2 [ Homo sapiens ] |
| Official Symbol | BCO2 |
| Synonyms | BCO2; beta-carotene oxygenase 2; BCDO2, beta carotene dioxygenase 2; beta,beta-carotene 9,10-oxygenase; B DIOX II; beta carotene 9; 10 oxygenase; FLJ34464; beta-carotene dioxygenase 2; beta-carotene 9,10 oxygenase; b,b-carotene-9,10-dioxygenase; beta,beta-carotene 9,10-dioxygenase variant 1; BCDO2; B-DIOX-II; |
| Gene ID | 83875 |
| mRNA Refseq | NM_001037290 |
| Protein Refseq | NP_001032367 |
| MIM | 611740 |
| UniProt ID | Q9BYV7 |
| ◆ Recombinant Proteins | ||
| BCO2-1073H | Recombinant Human BCO2 | +Inquiry |
| BCO2-340C | Recombinant Cynomolgus BCO2 Protein, His-tagged | +Inquiry |
| BCO2-88C | Recombinant Cynomolgus Monkey BCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCO2-173H | Recombinant Human BCO2 Protein, GST-tagged | +Inquiry |
| BCO2-2539H | Recombinant Human BCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCO2 Products
Required fields are marked with *
My Review for All BCO2 Products
Required fields are marked with *
