Recombinant Human BCS1L Protein, GST-tagged
| Cat.No. : | BCS1L-179H |
| Product Overview : | Human BCS1L partial ORF ( NP_004319, 320 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described. [provided by RefSeq] |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLR |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCS1L BCS1-like (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | BCS1L |
| Synonyms | BCS1L; BCS1-like (S. cerevisiae); BCS1 (yeast homolog) like , BCS1 like (yeast); mitochondrial chaperone BCS1; BCS; Bjornstad syndrome; BJS; GRACILE syndrome; h BCS; Hs.6719; h-BCS1; BCS1-like protein; mitochondrial complex III assembly; PTD; BCS1; FLNMS |
| Gene ID | 617 |
| mRNA Refseq | NM_001079866 |
| Protein Refseq | NP_001073335 |
| MIM | 603647 |
| UniProt ID | Q9Y276 |
| ◆ Recombinant Proteins | ||
| RFL30520XF | Recombinant Full Length Xenopus Laevis Mitochondrial Chaperone Bcs1(Bcs1L) Protein, His-Tagged | +Inquiry |
| BCS1L-356R | Recombinant Rhesus Macaque BCS1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCS1L-1658C | Recombinant Chicken BCS1L | +Inquiry |
| BCS1L-528R | Recombinant Rhesus monkey BCS1L Protein, His-tagged | +Inquiry |
| BCS1L-178H | Recombinant Human BCS1L Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCS1L-167HCL | Recombinant Human BCS1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCS1L Products
Required fields are marked with *
My Review for All BCS1L Products
Required fields are marked with *
