Recombinant Human BCS1L Protein, GST-tagged

Cat.No. : BCS1L-179H
Product Overview : Human BCS1L partial ORF ( NP_004319, 320 a.a. - 418 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BCS1L BCS1-like (S. cerevisiae) [ Homo sapiens ]
Official Symbol BCS1L
Synonyms BCS1L; BCS1-like (S. cerevisiae); BCS1 (yeast homolog) like , BCS1 like (yeast); mitochondrial chaperone BCS1; BCS; Bjornstad syndrome; BJS; GRACILE syndrome; h BCS; Hs.6719; h-BCS1; BCS1-like protein; mitochondrial complex III assembly; PTD; BCS1; FLNMS
Gene ID 617
mRNA Refseq NM_001079866
Protein Refseq NP_001073335
MIM 603647
UniProt ID Q9Y276

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCS1L Products

Required fields are marked with *

My Review for All BCS1L Products

Required fields are marked with *

0
cart-icon