Recombinant Human BLK Protein, GST-His-tagged

Cat.No. : BLK-240H
Product Overview : Human BLK partial ORF ( AAH07371, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.53 kDa
AA Sequence : MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLK B lymphoid tyrosine kinase [ Homo sapiens ]
Official Symbol BLK
Synonyms BLK; B lymphoid tyrosine kinase; tyrosine-protein kinase Blk; MGC10442; p55-Blk; b lymphocyte kinase; BLK nonreceptor tyrosine kinase; MODY11;
Gene ID 640
mRNA Refseq NM_001715
Protein Refseq NP_001706
MIM 191305
UniProt ID P51451

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLK Products

Required fields are marked with *

My Review for All BLK Products

Required fields are marked with *

0
cart-icon
0
compare icon