Recombinant Human BLK Protein, GST-His-tagged
| Cat.No. : | BLK-240H |
| Product Overview : | Human BLK partial ORF ( AAH07371, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BLK B lymphoid tyrosine kinase [ Homo sapiens ] |
| Official Symbol | BLK |
| Synonyms | BLK; B lymphoid tyrosine kinase; tyrosine-protein kinase Blk; MGC10442; p55-Blk; b lymphocyte kinase; BLK nonreceptor tyrosine kinase; MODY11; |
| Gene ID | 640 |
| mRNA Refseq | NM_001715 |
| Protein Refseq | NP_001706 |
| MIM | 191305 |
| UniProt ID | P51451 |
| ◆ Recombinant Proteins | ||
| BLK-10238H | Recombinant Human BLK, GST-tagged | +Inquiry |
| BLK-3316Z | Recombinant Zebrafish BLK | +Inquiry |
| BLK-1039M | Recombinant Mouse BLK Protein, His (Fc)-Avi-tagged | +Inquiry |
| BLK-8736HF | Active Recombinant Full Length Human BLK Protein, GST-tagged | +Inquiry |
| BLK-1345H | Recombinant Human B Lymphoid Tyrosine Kinase, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLK-614HCL | Recombinant Human BLK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLK Products
Required fields are marked with *
My Review for All BLK Products
Required fields are marked with *
