Recombinant Human BLK Protein, GST-His-tagged
Cat.No. : | BLK-240H |
Product Overview : | Human BLK partial ORF ( AAH07371, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLK B lymphoid tyrosine kinase [ Homo sapiens ] |
Official Symbol | BLK |
Synonyms | BLK; B lymphoid tyrosine kinase; tyrosine-protein kinase Blk; MGC10442; p55-Blk; b lymphocyte kinase; BLK nonreceptor tyrosine kinase; MODY11; |
Gene ID | 640 |
mRNA Refseq | NM_001715 |
Protein Refseq | NP_001706 |
MIM | 191305 |
UniProt ID | P51451 |
◆ Recombinant Proteins | ||
BLK-2414M | Recombinant Mouse BLK Protein | +Inquiry |
BLK-250H | Recombinant Human B lymphoid Tyrosine Kinase, GST-tagged, Active | +Inquiry |
BLK-5368H | Recombinant Human B Lymphoid Tyrosine Kinase, His-tagged | +Inquiry |
BLK-1514H | Recombinant Human BLK Protein (Leu241-Tyr494), N-His tagged | +Inquiry |
BLK-238H | Active Recombinant Human BLK Protein, GST-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLK-614HCL | Recombinant Human BLK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLK Products
Required fields are marked with *
My Review for All BLK Products
Required fields are marked with *
0
Inquiry Basket