Recombinant Human BLM Protein, GST-tagged
Cat.No. : | BLM-241H |
Product Overview : | Human BLM partial ORF ( NP_000048, 1196 a.a. - 1295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The Bloom syndrome gene product is related to the RecQ subset of DExH box-containing DNA helicases and has both DNA-stimulated ATPase and ATP-dependent DNA helicase activities. Mutations causing Bloom syndrome delete or alter helicase motifs and may disable the 3-5 helicase activity. The normal protein may act to suppress inappropriate recombination. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLM Bloom syndrome, RecQ helicase-like [ Homo sapiens ] |
Official Symbol | BLM |
Synonyms | BLM; Bloom syndrome, RecQ helicase-like; Bloom syndrome; Bloom syndrome protein; BS; RECQ2; RECQL3; recQ protein-like 3; DNA helicase, RecQ-like type 2; RECQL2; MGC126616; MGC131618; MGC131620; |
Gene ID | 641 |
mRNA Refseq | NM_000057 |
Protein Refseq | NP_000048 |
MIM | 604610 |
UniProt ID | P54132 |
◆ Recombinant Proteins | ||
BLM-34H | Recombinant Human BLM Protein | +Inquiry |
BLM-675H | Recombinant Human BLM protein, His-tagged | +Inquiry |
BLM-1040M | Recombinant Mouse BLM Protein, His (Fc)-Avi-tagged | +Inquiry |
BLM-2415M | Recombinant Mouse BLM Protein | +Inquiry |
BLM-241H | Recombinant Human BLM Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BLM Products
Required fields are marked with *
My Review for All BLM Products
Required fields are marked with *
0
Inquiry Basket