Recombinant Human BLNK Protein, GST-tagged

• Cat.No.: BLNK-245H
• Product Overview: Human BLNK partial ORF ( AAH18906, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLNK B-cell linker [ Homo sapiens ]
• Official Symbol: BLNK
• Synonyms: BLNK; B-cell linker; B-cell linker protein; B cell adaptor containing SH2 domain; B cell activation; B cell adapter containing a SH2 domain protein; BASH; bca; BLNK s; Ly57; SLP 65; SLP65; Src homology [SH2] domain containing leukocyte protein of 65 kD; B-cell activation; B cell linker protein; cytoplasmic adapter protein; B-cell adapter containing a SH2 domain protein; B-cell adapter containing a Src homology 2 domain protein; Src homology 2 domain-containing leukocyte protein of 65 kDa; Src homology [SH2] domain-containing leukocyte protein of 65 kD; AGM4; LY57; BLNK-S; SLP-65; MGC111051
• Gene ID: 29760
• mRNA Refseq: NM_001114094
• Protein Refseq: NP_001107566
• MIM: 604515
• UniProt ID: Q8WV28