Recombinant Human BLNK Protein, GST-tagged
Cat.No. : | BLNK-245H |
Product Overview : | Human BLNK partial ORF ( AAH18906, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRF |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLNK B-cell linker [ Homo sapiens ] |
Official Symbol | BLNK |
Synonyms | BLNK; B-cell linker; B-cell linker protein; B cell adaptor containing SH2 domain; B cell activation; B cell adapter containing a SH2 domain protein; BASH; bca; BLNK s; Ly57; SLP 65; SLP65; Src homology [SH2] domain containing leukocyte protein of 65 kD; B-cell activation; B cell linker protein; cytoplasmic adapter protein; B-cell adapter containing a SH2 domain protein; B-cell adapter containing a Src homology 2 domain protein; Src homology 2 domain-containing leukocyte protein of 65 kDa; Src homology [SH2] domain-containing leukocyte protein of 65 kD; AGM4; LY57; BLNK-S; SLP-65; MGC111051; |
Gene ID | 29760 |
mRNA Refseq | NM_001114094 |
Protein Refseq | NP_001107566 |
MIM | 604515 |
UniProt ID | Q8WV28 |
◆ Recombinant Proteins | ||
BLNK-406H | Recombinant Human BLNK Protein, His-tagged | +Inquiry |
BLNK-12102Z | Recombinant Zebrafish BLNK | +Inquiry |
BLNK-6875H | Active Recombinant Human BLNK protein, His-tagged | +Inquiry |
BLNK-988R | Recombinant Rat BLNK Protein | +Inquiry |
BLNK-3475H | Recombinant Human BLNK, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLNK-1858HCL | Recombinant Human BLNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLNK Products
Required fields are marked with *
My Review for All BLNK Products
Required fields are marked with *