Recombinant Human BLNK Protein, His-tagged
Cat.No. : | BLNK-406H |
Product Overview : | Recombinant Human BLNK, transcript variant 1, fused with C-terminal His was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2 |
Molecular Mass : | 51.5kD |
AA Sequence : | MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTP |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | BLNK B-cell linker [ Homo sapiens ] |
Official Symbol | BLNK |
Synonyms | BLNK; B-cell linker; B-cell linker protein; B cell adaptor containing SH2 domain; B cell activation; B cell adapter containing a SH2 domain protein; BASH; bca; BLNK s; Ly57; SLP 65; SLP65; Src homology [SH2] domain containing leukocyte protein of 65 kD; B-cell activation; B cell linker protein; cytoplasmic adapter protein; B-cell adapter containing a SH2 domain protein; B-cell adapter containing a Src homology 2 domain protein; Src homology 2 domain-containing leukocyte protein of 65 kDa; Src homology [SH2] domain-containing leukocyte protein of 65 kD; AGM4; LY57; BLNK-S; SLP-65; MGC111051; |
Gene ID | 29760 |
mRNA Refseq | NM_013314 |
Protein Refseq | NP_037446 |
MIM | 604515 |
UniProt ID | Q8WV28 |
◆ Recombinant Proteins | ||
BLNK-988R | Recombinant Rat BLNK Protein | +Inquiry |
BLNK-1042M | Recombinant Mouse BLNK Protein, His (Fc)-Avi-tagged | +Inquiry |
BLNK-245H | Recombinant Human BLNK Protein, GST-tagged | +Inquiry |
BLNK-3475H | Recombinant Human BLNK, His-tagged | +Inquiry |
BLNK-10240H | Recombinant Human BLNK, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLNK-1858HCL | Recombinant Human BLNK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLNK Products
Required fields are marked with *
My Review for All BLNK Products
Required fields are marked with *