Recombinant Human BLNK Protein, His-tagged

Cat.No. : BLNK-406H
Product Overview : Recombinant Human BLNK, transcript variant 1, fused with C-terminal His was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2
Molecular Mass : 51.5kD
AA Sequence : MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTP
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name BLNK B-cell linker [ Homo sapiens ]
Official Symbol BLNK
Synonyms BLNK; B-cell linker; B-cell linker protein; B cell adaptor containing SH2 domain; B cell activation; B cell adapter containing a SH2 domain protein; BASH; bca; BLNK s; Ly57; SLP 65; SLP65; Src homology [SH2] domain containing leukocyte protein of 65 kD; B-cell activation; B cell linker protein; cytoplasmic adapter protein; B-cell adapter containing a SH2 domain protein; B-cell adapter containing a Src homology 2 domain protein; Src homology 2 domain-containing leukocyte protein of 65 kDa; Src homology [SH2] domain-containing leukocyte protein of 65 kD; AGM4; LY57; BLNK-S; SLP-65; MGC111051;
Gene ID 29760
mRNA Refseq NM_013314
Protein Refseq NP_037446
MIM 604515
UniProt ID Q8WV28

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BLNK Products

Required fields are marked with *

My Review for All BLNK Products

Required fields are marked with *

0
cart-icon
0
compare icon