Recombinant Human BLVRA Protein, GST-tagged
Cat.No. : | BLVRA-249H |
Product Overview : | Human BLVRA full-length ORF ( AAH08456, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Biliverdin reductases, such as BLVRA (EC 1.3.1.24), catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH (Komuro et al., 1996 [PubMed 8950184]). |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 58.3 kDa |
AA Sequence : | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BLVRA biliverdin reductase A [ Homo sapiens ] |
Official Symbol | BLVRA |
Synonyms | BLVRA; biliverdin reductase A; BLVR; BVR A; biliverdin-IX alpha-reductase; BVR; BVRA; |
Gene ID | 644 |
mRNA Refseq | NM_000712 |
Protein Refseq | NP_000703 |
MIM | 109750 |
UniProt ID | P53004 |
◆ Recombinant Proteins | ||
BLVRA-1643H | Recombinant Human BLVRA protein, His-tagged | +Inquiry |
BLVRA-249H | Recombinant Human BLVRA Protein, GST-tagged | +Inquiry |
BLVRA-1712HF | Recombinant Full Length Human BLVRA Protein, GST-tagged | +Inquiry |
BLVRA-1687H | Recombinant Human BLVRA protein, His & T7-tagged | +Inquiry |
BLVRA-0766H | Recombinant Human BLVRA Protein (Glu6-Ser294), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BLVRA-8441HCL | Recombinant Human BLVRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLVRA Products
Required fields are marked with *
My Review for All BLVRA Products
Required fields are marked with *