Recombinant Full Length Human BLVRA Protein, GST-tagged
| Cat.No. : | BLVRA-1712HF |
| Product Overview : | Human BLVRA full-length ORF ( AAH08456, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 296 amino acids |
| Description : | Biliverdin reductases, such as BLVRA (EC 1.3.1.24), catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH (Komuro et al., 1996 [PubMed 8950184]). |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 58.3 kDa |
| AA Sequence : | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BLVRA biliverdin reductase A [ Homo sapiens ] |
| Official Symbol | BLVRA |
| Synonyms | BLVRA; biliverdin reductase A; BLVR; BVR A; biliverdin-IX alpha-reductase; BVR; BVRA |
| Gene ID | 644 |
| mRNA Refseq | NM_000712 |
| Protein Refseq | NP_000703 |
| MIM | 109750 |
| UniProt ID | P53004 |
| ◆ Recombinant Proteins | ||
| Blvra-4719M | Recombinant Mouse Blvra protein, His-tagged | +Inquiry |
| BLVRA-10242H | Recombinant Human BLVRA protein, GST-tagged | +Inquiry |
| BLVRA-5804H | Recombinant Human BLVRA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BLVRA-373R | Recombinant Rhesus Macaque BLVRA Protein, His (Fc)-Avi-tagged | +Inquiry |
| BLVRA-1234H | Recombinant Human BLVRA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BLVRA-8441HCL | Recombinant Human BLVRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BLVRA Products
Required fields are marked with *
My Review for All BLVRA Products
Required fields are marked with *
