Recombinant Human BNIP3L protein, GST-tagged
| Cat.No. : | BNIP3L-7855H |
| Product Overview : | Recombinant Human BNIP3L protein(77-146 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 77-146 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like [ Homo sapiens ] |
| Official Symbol | BNIP3L |
| Synonyms | BNIP3L; BCL2/adenovirus E1B 19kDa interacting protein 3-like; BCL2/adenovirus E1B 19kD interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BNIP3a; Nix; NIP3L; NIP3-like protein X; adenovirus E1B19k-binding protein B5; BCL2/adenovirus E1B 19-kd protein-interacting protein 3a; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A; NIX; |
| Gene ID | 665 |
| mRNA Refseq | NM_004331 |
| Protein Refseq | NP_004322 |
| MIM | 605368 |
| UniProt ID | O60238 |
| ◆ Recombinant Proteins | ||
| BNIP3L-95C | Recombinant Cynomolgus Monkey BNIP3L Protein, His (Fc)-Avi-tagged | +Inquiry |
| BNIP3L-1063M | Recombinant Mouse BNIP3L Protein, His (Fc)-Avi-tagged | +Inquiry |
| BNIP3L-550R | Recombinant Rhesus monkey BNIP3L Protein, His-tagged | +Inquiry |
| BNIP3L-2576C | Recombinant Chicken BNIP3L | +Inquiry |
| BNIP3L-26756TH | Recombinant Human BNIP3L | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BNIP3L-8422HCL | Recombinant Human BNIP3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP3L Products
Required fields are marked with *
My Review for All BNIP3L Products
Required fields are marked with *




