Recombinant Human BRSK2 Protein, GST-tagged
| Cat.No. : | BRSK2-351H |
| Product Overview : | Human BRSK2 full-length ORF ( AAH24291.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ] |
| Official Symbol | BRSK2 |
| Synonyms | BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362; |
| Gene ID | 9024 |
| mRNA Refseq | NM_001256627 |
| Protein Refseq | NP_001243556 |
| MIM | 609236 |
| UniProt ID | Q8IWQ3 |
| ◆ Recombinant Proteins | ||
| BRSK2-505H | Recombinant Human BR Serine/Threonine Kinase 2, His-tagged | +Inquiry |
| BRSK2-4411C | Recombinant Chicken BRSK2 | +Inquiry |
| BRSK2-351H | Recombinant Human BRSK2 Protein, GST-tagged | +Inquiry |
| BRSK2-8365HF | Active Recombinant Full Length Human BRSK2 Protein, GST-tagged | +Inquiry |
| Brsk2-1895M | Recombinant Mouse Brsk2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BRSK2-8403HCL | Recombinant Human BRSK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRSK2 Products
Required fields are marked with *
My Review for All BRSK2 Products
Required fields are marked with *
