Recombinant Human BRSK2 Protein, GST-tagged

Cat.No. : BRSK2-351H
Product Overview : Human BRSK2 full-length ORF ( AAH24291.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.9 kDa
AA Sequence : MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ]
Official Symbol BRSK2
Synonyms BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362;
Gene ID 9024
mRNA Refseq NM_001256627
Protein Refseq NP_001243556
MIM 609236
UniProt ID Q8IWQ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRSK2 Products

Required fields are marked with *

My Review for All BRSK2 Products

Required fields are marked with *

0
cart-icon