Recombinant Human BRSK2 Protein, GST-tagged
Cat.No. : | BRSK2-351H |
Product Overview : | Human BRSK2 full-length ORF ( AAH24291.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ] |
Official Symbol | BRSK2 |
Synonyms | BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362; |
Gene ID | 9024 |
mRNA Refseq | NM_001256627 |
Protein Refseq | NP_001243556 |
MIM | 609236 |
UniProt ID | Q8IWQ3 |
◆ Recombinant Proteins | ||
BRSK2-505H | Recombinant Human BR Serine/Threonine Kinase 2, His-tagged | +Inquiry |
BRSK2-1094M | Recombinant Mouse BRSK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Brsk2-1895M | Recombinant Mouse Brsk2 Protein, Myc/DDK-tagged | +Inquiry |
BRSK2-351H | Recombinant Human BRSK2 Protein, GST-tagged | +Inquiry |
BRSK2-1173H | Recombinant Human BRSK2 Protein (T2-P736), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRSK2-8403HCL | Recombinant Human BRSK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRSK2 Products
Required fields are marked with *
My Review for All BRSK2 Products
Required fields are marked with *
0
Inquiry Basket