Recombinant Full Length Human BRSK2 Protein, GST-tagged
Cat.No. : | BRSK2-3811HF |
Product Overview : | Human BRSK2 full-length ORF ( AAH24291.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 170 amino acids |
Description : | The protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is thought to function in regulating mitosis and cytokinesis. Mutations in this gene result in nonphotosensitive trichothiodystrophy. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ] |
Official Symbol | BRSK2 |
Synonyms | BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362; |
Gene ID | 9024 |
mRNA Refseq | NM_001256627 |
Protein Refseq | NP_001243556 |
MIM | 609236 |
UniProt ID | Q8IWQ3 |
◆ Recombinant Proteins | ||
BRSK2-1172H | Recombinant Human BRSK2 Protein (T2-P736), Tag Free | +Inquiry |
BRSK2-505H | Recombinant Human BR Serine/Threonine Kinase 2, His-tagged | +Inquiry |
BRSK2-301152H | Recombinant Human BRSK2 protein, GST-tagged | +Inquiry |
BRSK2-257H | Active Recombinant Human BRSK2, GST-tagged | +Inquiry |
BRSK2-3811HF | Recombinant Full Length Human BRSK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRSK2-8403HCL | Recombinant Human BRSK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRSK2 Products
Required fields are marked with *
My Review for All BRSK2 Products
Required fields are marked with *