Recombinant Human BSG Protein, His-Tagged
Cat.No. : | BSG-013H |
Product Overview : | Recombinant Human BSG protein(NP_001309172.1)(Glu138~Ala323), fused to His-tag at N-terminus, was expressed in HEK293F. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Glu138~Ala323 |
Description : | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : | 27kd-33kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 90% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8ºC for one month. Aliquot and store at -80ºC for 12 months. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | BSG basigin (Ok blood group) [ Homo sapiens (human) ] |
Official Symbol | BSG |
Synonyms | EMMPRIN; BSG; 5F7; M6; OK; TCSF; Basigin(Ok Blood Group); Collagenase stimulatory factor; OK blood group antigen; Tumor cell-derived collagenase stimulatory factor |
Gene ID | 682 |
mRNA Refseq | NM_001322243.2 |
Protein Refseq | NP_001309172.1 |
MIM | 109480 |
UniProt ID | P35613 |
◆ Recombinant Proteins | ||
BSG-3001H | Recombinant Human BSG Protein (Ala22-His205), C-His tagged | +Inquiry |
BSG-1413H | Active Recombinant Human BSG protein, His-tagged, FITC-Labeled | +Inquiry |
BSG-613H | Recombinant Human BSG protein, mFc-tagged | +Inquiry |
BSG-3874H | Recombinant Human BSG Protein(138-321aa), His-tagged | +Inquiry |
BSG-217H | Recombinant Human BSG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *