Recombinant Human BSG Protein, His-Tagged

Cat.No. : BSG-013H
Product Overview : Recombinant Human BSG protein(NP_001309172.1)(Glu138~Ala323), fused to His-tag at N-terminus, was expressed in HEK293F.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Glu138~Ala323
Description : The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 27kd-33kDa as determined by SDS-PAGE reducing conditions.
AA Sequence : EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 90%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein.
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles.
Store at 2-8ºC for one month.
Aliquot and store at -80ºC for 12 months.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name BSG basigin (Ok blood group) [ Homo sapiens (human) ]
Official Symbol BSG
Synonyms EMMPRIN; BSG; 5F7; M6; OK; TCSF; Basigin(Ok Blood Group); Collagenase stimulatory factor; OK blood group antigen; Tumor cell-derived collagenase stimulatory factor
Gene ID 682
mRNA Refseq NM_001322243.2
Protein Refseq NP_001309172.1
MIM 109480
UniProt ID P35613

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BSG Products

Required fields are marked with *

My Review for All BSG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon