Recombinant Human BSND Protein, GST-tagged
Cat.No. : | BSND-360H |
Product Overview : | Human BSND full-length ORF (1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 61.6 kDa |
AA Sequence : | MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BSND Bartter syndrome, infantile, with sensorineural deafness (Barttin) [ Homo sapiens ] |
Official Symbol | BSND |
Synonyms | BSND; Bartter syndrome, infantile, with sensorineural deafness (Barttin); deafness, autosomal recessive 73 , DFNB73; barttin; BART; deafness, autosomal recessive 73; DFNB73; MGC119283; MGC119284; MGC119285; |
Gene ID | 7809 |
mRNA Refseq | NM_057176 |
Protein Refseq | NP_476517 |
MIM | 606412 |
UniProt ID | Q8WZ55 |
◆ Recombinant Proteins | ||
BSND-250H | Recombinant Human Bartter syndrome, infantile, with sensorineural deafness (Barttin), His-tagged | +Inquiry |
BSND-1099M | Recombinant Mouse BSND Protein, His (Fc)-Avi-tagged | +Inquiry |
BSND-10305H | Recombinant Human BSND, GST-tagged | +Inquiry |
BSND-360H | Recombinant Human BSND Protein, GST-tagged | +Inquiry |
BSND-1023R | Recombinant Rat BSND Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSND-8401HCL | Recombinant Human BSND 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSND Products
Required fields are marked with *
My Review for All BSND Products
Required fields are marked with *