Recombinant Human BST1 Protein, GST-tagged
| Cat.No. : | BST1-363H |
| Product Overview : | Human BST1 full-length ORF ( AAH12095.1, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 60.39 kDa |
| AA Sequence : | MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BST1 bone marrow stromal cell antigen 1 [ Homo sapiens ] |
| Official Symbol | BST1 |
| Synonyms | BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2; |
| Gene ID | 683 |
| mRNA Refseq | NM_004334 |
| Protein Refseq | NP_004325 |
| MIM | 600387 |
| UniProt ID | Q10588 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BST1 Products
Required fields are marked with *
My Review for All BST1 Products
Required fields are marked with *




