"BST1" Related Products

Expand
Expand

Recombinant Human BST1 Protein, His-tagged

Cat.No. : BST1-001H
Product Overview : Recombinant human BST1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description : BST1, also known as ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, is a glycosylphosphatidyl inositol (GPI) anchored membrane protein that belongs to the CD38 family. It was originally identified as a bone marrow stromal cell molecule. This protein is an ectoenzyme sharing several characteristics with ADP-ribosyl cyclase CD38. Along with CD38, it exhibits both DP-ribosyl cyclase and cyclinc ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Also, it is expressed by cells of the myeloid lineage and could act as a receptor with signal transduction capability.
Source : Insect cell
Species : Human
Tag : His
Form : Liquid
Molecular Mass : 30.5 kDa
AASequence : RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAHHHHHH
N-terminal Sequence Analysis : Arg 33
Endotoxin : < 0.1 EU per 1μg of protein (determined by LAL method)
Purity : > 95% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
SDS-PAGE :

15% SDS-PAGE (3 μg)

Gene Name : BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ]
Official Symbol : BST1
Synonyms : BST1; bone marrow stromal cell antigen 1; CD157; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; ADP-ribosyl cyclase 2; NAD(+) nucleosidase; bone marrow stromal antigen 1; bone marrow stromal cell antigen 1 variant 2; cADPr hydrolase 2; cyclic ADP-ribose hydrolase 2; EC 3.2.2.6
Gene ID : 683
mRNA Refseq : NM_004334
Protein Refseq : NP_004325
MIM : 600387
UniProt ID : Q10588

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.