Recombinant Human BST1 Protein, His-tagged

• Cat.No.: BST1-001H
• Product Overview: Recombinant human BST1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Description: BST1, also known as ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, is a glycosylphosphatidyl inositol (GPI) anchored membrane protein that belongs to the CD38 family. It was originally identified as a bone marrow stromal cell molecule. This protein is an ectoenzyme sharing several characteristics with ADP-ribosyl cyclase CD38. Along with CD38, it exhibits both DP-ribosyl cyclase and cyclinc ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Also, it is expressed by cells of the myeloid lineage and could act as a receptor with signal transduction capability.
• Form: Liquid
• Molecular Mass: 30.5 kDa
• N-terminal Sequence Analysis: Arg 33
• Endotoxin: < 0.1 EU per 1μg of protein (determined by LAL method)
• Purity: > 95% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
• Warning: For research use only. This product is not intended or approved for human, diagnostics or veterin
• AA Sequence: RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAHHHHHH

Gene Information

• Gene Name: BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ]
• Official Symbol: BST1
• Synonyms: BST1; bone marrow stromal cell antigen 1; CD157; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; ADP-ribosyl cyclase 2; NAD(+) nucleosidase; bone marrow stromal antigen 1; bone marrow stromal cell antigen 1 variant 2; cADPr hydrolase 2; cyclic ADP-ribose hydrolase 2; EC 3.2.2.6
• Gene ID: 683
• mRNA Refseq: NM_004334
• Protein Refseq: NP_004325
• MIM: 600387
• UniProt ID: Q10588