Recombinant Human BST1 Protein, His-tagged

Cat.No. : BST1-001H
Product Overview : Recombinant human BST1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Description : BST1, also known as ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, is a glycosylphosphatidyl inositol (GPI) anchored membrane protein that belongs to the CD38 family. It was originally identified as a bone marrow stromal cell molecule. This protein is an ectoenzyme sharing several characteristics with ADP-ribosyl cyclase CD38. Along with CD38, it exhibits both DP-ribosyl cyclase and cyclinc ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Also, it is expressed by cells of the myeloid lineage and could act as a receptor with signal transduction capability.
Form : Liquid
Molecular Mass : 30.5 kDa
N-terminal Sequence Analysis : Arg 33
Endotoxin : < 0.1 EU per 1μg of protein (determined by LAL method)
Purity : > 95% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAHHHHHH
Gene Name BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ]
Official Symbol BST1
Synonyms BST1; bone marrow stromal cell antigen 1; CD157; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; ADP-ribosyl cyclase 2; NAD(+) nucleosidase; bone marrow stromal antigen 1; bone marrow stromal cell antigen 1 variant 2; cADPr hydrolase 2; cyclic ADP-ribose hydrolase 2; EC 3.2.2.6
Gene ID 683
mRNA Refseq NM_004334
Protein Refseq NP_004325
MIM 600387
UniProt ID Q10588

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BST1 Products

Required fields are marked with *

My Review for All BST1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon