| Species : |
Human |
| Source : |
Insect Cells |
| Tag : |
His |
| Description : |
BST1, also known as ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, is a glycosylphosphatidyl inositol (GPI) anchored membrane protein that belongs to the CD38 family. It was originally identified as a bone marrow stromal cell molecule. This protein is an ectoenzyme sharing several characteristics with ADP-ribosyl cyclase CD38. Along with CD38, it exhibits both DP-ribosyl cyclase and cyclinc ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Also, it is expressed by cells of the myeloid lineage and could act as a receptor with signal transduction capability. |
| Form : |
Liquid |
| Molecular Mass : |
30.5 kDa |
| N-terminal Sequence Analysis : |
Arg 33 |
| Endotoxin : |
< 0.1 EU per 1μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS - PAGE |
| Storage : |
Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : |
In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
| Warning : |
For research use only. This product is not intended or approved for human, diagnostics or veterin |
| AA Sequence : |
RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAHHHHHH |
