Recombinant Human BTBD8 Protein, GST-tagged
Cat.No. : | BTBD8-374H |
Product Overview : | Human BTBD8 full-length ORF ( NP_899065.1, 1 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 69.2 kDa |
AA Sequence : | MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPPEIQKSCLNMLIQSLVNIT |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BTBD8 BTB (POZ) domain containing 8 [ Homo sapiens ] |
Official Symbol | BTBD8 |
Synonyms | BTBD8; BTB (POZ) domain containing 8; BTB/POZ domain-containing protein 8; double BTB/POZ domain containing protein; |
Gene ID | 284697 |
mRNA Refseq | NM_183242 |
Protein Refseq | NP_899065 |
UniProt ID | Q5XKL5 |
◆ Recombinant Proteins | ||
BTBD8-2525M | Recombinant Mouse BTBD8 Protein | +Inquiry |
BTBD8-374H | Recombinant Human BTBD8 Protein, GST-tagged | +Inquiry |
BTBD8-10313H | Recombinant Human BTBD8, GST-tagged | +Inquiry |
BTBD8-1663HF | Recombinant Full Length Human BTBD8 Protein, GST-tagged | +Inquiry |
BTBD8-1108M | Recombinant Mouse BTBD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTBD8-191HCL | Recombinant Human BTBD8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTBD8 Products
Required fields are marked with *
My Review for All BTBD8 Products
Required fields are marked with *
0
Inquiry Basket