Recombinant Human C11orf49 Protein, GST-tagged
| Cat.No. : | C11orf49-470H |
| Product Overview : | Human C11orf49 full-length ORF ( NP_001003677.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 64.5 kDa |
| AA Sequence : | MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLLPFFRLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf49 chromosome 11 open reading frame 49 [ Homo sapiens ] |
| Official Symbol | C11orf49 |
| Synonyms | C11orf49 |
| Gene ID | 79096 |
| mRNA Refseq | NM_024113.3 |
| Protein Refseq | NP_077018.1 |
| UniProt ID | Q9H6J7 |
| ◆ Recombinant Proteins | ||
| C11orf49-470H | Recombinant Human C11orf49 Protein, GST-tagged | +Inquiry |
| C11orf49-10358H | Recombinant Human C11orf49, GST-tagged | +Inquiry |
| C11orf49-1281H | Recombinant Human C11orf49 Protein, GST/His-tagged | +Inquiry |
| C11orf49-1279H | Recombinant Human C11orf49 Protein, His-tagged | +Inquiry |
| C11orf49-4154H | Recombinant Human C11orf49 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C11orf49-8347HCL | Recombinant Human C11orf49 293 Cell Lysate | +Inquiry |
| C11orf49-8349HCL | Recombinant Human C11orf49 293 Cell Lysate | +Inquiry |
| C11orf49-8348HCL | Recombinant Human C11orf49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf49 Products
Required fields are marked with *
My Review for All C11orf49 Products
Required fields are marked with *
