Recombinant Human C11orf70 Protein, GST-tagged
Cat.No. : | C11orf70-482H |
Product Overview : | Human C11orf70 full-length ORF ( NP_116319.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 52.9 kDa |
AA Sequence : | MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf70 chromosome 11 open reading frame 70 [ Homo sapiens ] |
Official Symbol | C11orf70 |
Synonyms | C11orf70 |
Gene ID | 85016 |
mRNA Refseq | NM_032930.2 |
Protein Refseq | NP_116319.2 |
UniProt ID | Q9BRQ4 |
◆ Recombinant Proteins | ||
C11orf70-482H | Recombinant Human C11orf70 Protein, GST-tagged | +Inquiry |
C11orf70-1277H | Recombinant Human C11orf70 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf70-8337HCL | Recombinant Human C11orf70 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf70 Products
Required fields are marked with *
My Review for All C11orf70 Products
Required fields are marked with *