Recombinant Human C11orf85 Protein, GST-tagged
| Cat.No. : | C11orf85-489H |
| Product Overview : | Human C11orf85 full-length ORF ( NP_001032302.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 51.2 kDa |
| AA Sequence : | MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHFIVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHENLSPGKPISDSPLGLVPVEKKAVGAVMRKRKHMDEPSSPSRPGLDRIGKEKPNKDCRRLWPLISLMSRNKILSGDTACQGELSHPCSTTHLHLRSEQPPASLGF |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf85 chromosome 11 open reading frame 85 [ Homo sapiens ] |
| Official Symbol | C11orf85 |
| Synonyms | C11ORF85; chromosome 11 open reading frame 85; uncharacterized protein C11orf85; hypothetical protein LOC283129; LOC283129; MGC126364; |
| Gene ID | 283129 |
| mRNA Refseq | NM_001037225 |
| Protein Refseq | NP_001032302 |
| UniProt ID | Q3KP22 |
| ◆ Recombinant Proteins | ||
| C11orf85-489H | Recombinant Human C11orf85 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C11orf85-8331HCL | Recombinant Human C11orf85 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf85 Products
Required fields are marked with *
My Review for All C11orf85 Products
Required fields are marked with *
