Recombinant Human C11orf85 Protein, GST-tagged

Cat.No. : C11orf85-489H
Product Overview : Human C11orf85 full-length ORF ( NP_001032302.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 51.2 kDa
AA Sequence : MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHFIVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHENLSPGKPISDSPLGLVPVEKKAVGAVMRKRKHMDEPSSPSRPGLDRIGKEKPNKDCRRLWPLISLMSRNKILSGDTACQGELSHPCSTTHLHLRSEQPPASLGF
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf85 chromosome 11 open reading frame 85 [ Homo sapiens ]
Official Symbol C11orf85
Synonyms C11ORF85; chromosome 11 open reading frame 85; uncharacterized protein C11orf85; hypothetical protein LOC283129; LOC283129; MGC126364;
Gene ID 283129
mRNA Refseq NM_001037225
Protein Refseq NP_001032302
UniProt ID Q3KP22

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf85 Products

Required fields are marked with *

My Review for All C11orf85 Products

Required fields are marked with *

0
cart-icon
0
compare icon