Recombinant Human C12orf42 Protein, GST-tagged
| Cat.No. : | C12orf42-503H |
| Product Overview : | Human C12orf42 full-length ORF ( AAH44617.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 55 kDa |
| AA Sequence : | MACKRLLHTCQYIVPRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKQAWNSSFLEQLVKKPNWAHSVNPVHLEAQGIHISRHTRPKGQPLSSPKKNSGSAARPSTAIGLCRRSQTPGALQSTGPSNTELEPEERMAVPAGAQAHPDDIQSRLLGASGNPVGKGAVAMAPEMLPKHPHTPRDRRPQADTSLHGNLAGAPLPLLAGASTHFPSKRLIKVCSSAPPRPTRRFHTVCSQALSRPVVNAHLH |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C12orf42 chromosome 12 open reading frame 42 [ Homo sapiens ] |
| Official Symbol | C12orf42 |
| Synonyms | C12ORF42; chromosome 12 open reading frame 42; uncharacterized protein C12orf42; FLJ25323; MGC43592; MGC57409; |
| Gene ID | 374470 |
| mRNA Refseq | NM_001099336 |
| Protein Refseq | NP_001092806 |
| UniProt ID | Q96LP6 |
| ◆ Recombinant Proteins | ||
| C12orf42-503H | Recombinant Human C12orf42 Protein, GST-tagged | +Inquiry |
| C12orf42-1750HF | Recombinant Full Length Human C12orf42 Protein, GST-tagged | +Inquiry |
| C12orf42-1270H | Recombinant Human C12orf42 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12orf42 Products
Required fields are marked with *
My Review for All C12orf42 Products
Required fields are marked with *
