Recombinant Human C12orf49 Protein, GST-tagged
Cat.No. : | C12orf49-507H |
Product Overview : | Human C12orf49 full-length ORF (BAB15058.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50 kDa |
AA Sequence : | MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA |
Endotoxin : | <0.1 ng/ug (<1 EU/ug) |
Storage : | Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C12orf49 chromosome 12 open reading frame 49 [ Homo sapiens ] |
Official Symbol | C12orf49 |
Synonyms | C12ORF49; chromosome 12 open reading frame 49; UPF0454 protein C12orf49; FLJ21415; |
Gene ID | 79794 |
mRNA Refseq | NM_024738 |
Protein Refseq | NP_079014 |
UniProt ID | Q9H741 |
◆ Recombinant Proteins | ||
C12ORF49-1124H | Recombinant Human C12ORF49 Protein (34-205 aa), His-SUMO-tagged | +Inquiry |
C12orf49-507H | Recombinant Human C12orf49 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C12orf49-8317HCL | Recombinant Human C12orf49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12orf49 Products
Required fields are marked with *
My Review for All C12orf49 Products
Required fields are marked with *