Recombinant Human C12orf49 Protein, GST-tagged
| Cat.No. : | C12orf49-507H | 
| Product Overview : | Human C12orf49 full-length ORF (BAB15058.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Molecular Mass : | 50 kDa | 
| AA Sequence : | MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA | 
| Endotoxin : | <0.1 ng/ug (<1 EU/ug) | 
| Storage : | Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C12orf49 chromosome 12 open reading frame 49 [ Homo sapiens ] | 
| Official Symbol | C12orf49 | 
| Synonyms | C12ORF49; chromosome 12 open reading frame 49; UPF0454 protein C12orf49; FLJ21415; | 
| Gene ID | 79794 | 
| mRNA Refseq | NM_024738 | 
| Protein Refseq | NP_079014 | 
| UniProt ID | Q9H741 | 
| ◆ Recombinant Proteins | ||
| C12orf49-507H | Recombinant Human C12orf49 Protein, GST-tagged | +Inquiry | 
| C12ORF49-1124H | Recombinant Human C12ORF49 Protein (34-205 aa), His-SUMO-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C12orf49-8317HCL | Recombinant Human C12orf49 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All C12orf49 Products
Required fields are marked with *
My Review for All C12orf49 Products
Required fields are marked with *
  
        
    
      
            