Recombinant Human C12orf61 Protein, GST-tagged
| Cat.No. : | C12orf61-514H |
| Product Overview : | Human C12orf61 full-length ORF (BAC05309.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 39.8 kDa |
| AA Sequence : | MGGKSAVRHQLVLDCPREAASSAPALRPLGAAATSRAAPLAPLPAPSPRWGLGCGRVRYPGPHPRRAVEPAAGPLSAPIIAGGHPAEAAAGSAKQQPRHSREVPRPPVPQHPSGNSRSALQEAKTEQTKTP |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C12orf61 chromosome 12 open reading frame 61 [ Homo sapiens ] |
| Official Symbol | C12orf61 |
| Synonyms | C12ORF61; chromosome 12 open reading frame 61; putative uncharacterized protein C12orf61; FLJ25590; |
| Gene ID | 283416 |
| mRNA Refseq | NM_175895 |
| Protein Refseq | NP_787091 |
| UniProt ID | Q8N7H1 |
| ◆ Recombinant Proteins | ||
| C12orf61-514H | Recombinant Human C12orf61 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C12orf61 Products
Required fields are marked with *
My Review for All C12orf61 Products
Required fields are marked with *
