Recombinant Human C12orf61 Protein, GST-tagged

Cat.No. : C12orf61-514H
Product Overview : Human C12orf61 full-length ORF (BAC05309.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.8 kDa
AA Sequence : MGGKSAVRHQLVLDCPREAASSAPALRPLGAAATSRAAPLAPLPAPSPRWGLGCGRVRYPGPHPRRAVEPAAGPLSAPIIAGGHPAEAAAGSAKQQPRHSREVPRPPVPQHPSGNSRSALQEAKTEQTKTP
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C12orf61 chromosome 12 open reading frame 61 [ Homo sapiens ]
Official Symbol C12orf61
Synonyms C12ORF61; chromosome 12 open reading frame 61; putative uncharacterized protein C12orf61; FLJ25590;
Gene ID 283416
mRNA Refseq NM_175895
Protein Refseq NP_787091
UniProt ID Q8N7H1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C12orf61 Products

Required fields are marked with *

My Review for All C12orf61 Products

Required fields are marked with *

0
cart-icon