Recombinant Human C13orf33 Protein, GST-tagged

Cat.No. : C13orf33-528H
Product Overview : Human C13orf33 full-length ORF (BAB70975.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 60.5 kDa
AA Sequence : MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C13orf33 chromosome 13 open reading frame 33 [ Homo sapiens ]
Official Symbol C13orf33
Synonyms C13ORF33; chromosome 13 open reading frame 33; uncharacterized protein C13orf33; AWMS3; FLJ14834; activated in W/Wv mouse stomach 3 homolog; hAWMS3; MGC126673; MGC126675;
Gene ID 84935
mRNA Refseq NM_032849
Protein Refseq NP_116238
UniProt ID Q5VYS4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C13orf33 Products

Required fields are marked with *

My Review for All C13orf33 Products

Required fields are marked with *

0
cart-icon