Recombinant Human C13orf33 Protein, GST-tagged

• Cat.No.: C13orf33-528H
• Product Overview: Human C13orf33 full-length ORF (BAB70975.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 60.5 kDa
• AA Sequence: MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C13orf33 chromosome 13 open reading frame 33 [ Homo sapiens ]
• Official Symbol: C13orf33
• Synonyms: C13ORF33; chromosome 13 open reading frame 33; uncharacterized protein C13orf33; AWMS3; FLJ14834; activated in W/Wv mouse stomach 3 homolog; hAWMS3; MGC126673; MGC126675
• Gene ID: 84935
• mRNA Refseq: NM_032849
• Protein Refseq: NP_116238
• UniProt ID: Q5VYS4