Recombinant Human C17orf49 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C17orf49-2365H
Product Overview : C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of chromatin complexes such as the MLL1/MLL and NURF complexes.
Molecular Mass : 13.8 kDa
AA Sequence : MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C17orf49 chromosome 17 open reading frame 49 [ Homo sapiens (human) ]
Official Symbol C17orf49
Synonyms C17ORF49; chromosome 17 open reading frame 49; chromatin complexes subunit BAP18; MGC49942; BPTF-associated protein of 18 kDa; MLL1/MLL complex subunit C17orf49; BAP18;
Gene ID 124944
mRNA Refseq NM_001142799
Protein Refseq NP_001136271
MIM 617215
UniProt ID Q8IXM2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C17orf49 Products

Required fields are marked with *

My Review for All C17orf49 Products

Required fields are marked with *

0
cart-icon