Recombinant Human C17orf49 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C17orf49-2365H
• Product Overview: C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Component of chromatin complexes such as the MLL1/MLL and NURF complexes.
• Molecular Mass: 13.8 kDa
• AA Sequence: MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C17orf49 chromosome 17 open reading frame 49 [ Homo sapiens (human) ]
• Official Symbol: C17orf49
• Synonyms: C17ORF49; chromosome 17 open reading frame 49; chromatin complexes subunit BAP18; MGC49942; BPTF-associated protein of 18 kDa; MLL1/MLL complex subunit C17orf49; BAP18
• Gene ID: 124944
• mRNA Refseq: NM_001142799
• Protein Refseq: NP_001136271
• MIM: 617215
• UniProt ID: Q8IXM2