Recombinant Human C17orf49 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C17orf49-2365H |
| Product Overview : | C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Component of chromatin complexes such as the MLL1/MLL and NURF complexes. |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C17orf49 chromosome 17 open reading frame 49 [ Homo sapiens (human) ] |
| Official Symbol | C17orf49 |
| Synonyms | C17ORF49; chromosome 17 open reading frame 49; chromatin complexes subunit BAP18; MGC49942; BPTF-associated protein of 18 kDa; MLL1/MLL complex subunit C17orf49; BAP18; |
| Gene ID | 124944 |
| mRNA Refseq | NM_001142799 |
| Protein Refseq | NP_001136271 |
| MIM | 617215 |
| UniProt ID | Q8IXM2 |
| ◆ Recombinant Proteins | ||
| C17orf49-592H | Recombinant Human C17orf49 Protein, MYC/DDK-tagged | +Inquiry |
| C17orf49-2365H | Recombinant Human C17orf49 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C17orf49-587H | Recombinant Human C17orf49 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C17orf49-213HCL | Recombinant Human C17orf49 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C17orf49 Products
Required fields are marked with *
My Review for All C17orf49 Products
Required fields are marked with *
