Recombinant Human C17orf99 protein, His&Myc-tagged
Cat.No. : | C17orf99-92H |
Product Overview : | Recombinant Human C17orf99 protein(Q6UX52)(182-265aa), fused with N-terminal His tag and C-terminal Myc tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 182-265aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.8 kDa |
AA Sequence : | FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. |
Gene Name | C17orf99 chromosome 17 open reading frame 99 [ Homo sapiens ] |
Official Symbol | C17orf99 |
Synonyms | UNQ464 |
Gene ID | 100141515 |
mRNA Refseq | NM_001163075.1 |
Protein Refseq | NP_001156547.1 |
UniProt ID | Q6UX52 |
◆ Recombinant Proteins | ||
C17orf99-93H | Recombinant Human C17orf99 protein, hFc-tagged | +Inquiry |
C17orf99-92H | Recombinant Human C17orf99 protein, His&Myc-tagged | +Inquiry |
C17orf99-91H | Recombinant Human C17orf99 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C17orf99 Products
Required fields are marked with *
My Review for All C17orf99 Products
Required fields are marked with *