Recombinant Human C6orf136 Protein, GST-Tagged

• Cat.No.: C6orf136-0107H
• Product Overview: Human C6orf136 full-length ORF (NP_659466.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C6orf136 (Chromosome 6 Open Reading Frame 136) is a Protein Coding gene.
• Molecular Mass: 46.9 kDa
• AA Sequence: MEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAHLRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLMPSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C6orf136 chromosome 6 open reading frame 136 [ Homo sapiens (human) ]
• Official Symbol: C6orf136
• Synonyms: C6orf136; chromosome 6 open reading frame 136; uncharacterized protein C6orf136; Chromosome 6 Open Reading Frame 136
• Gene ID: 221545
• mRNA Refseq: NM_001109938
• Protein Refseq: NP_001103408
• UniProt ID: Q5SQH8