Recombinant Human C9orf9 protein, His-tagged
| Cat.No. : | C9orf9-191H |
| Product Overview : | Recombinant human C9ORF9 cDNA (221aa, which derived from BC012940) fused with a human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 221 a.a. |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
| AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFNEVKES LRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQH FEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEK LPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | C9orf9 chromosome 9 open reading frame 9 [ Homo sapiens ] |
| Official Symbol | C9orf9 |
| Synonyms | C9ORF9; chromosome 9 open reading frame 9; uncharacterized protein C9orf9; Rsb66 homolog; FLJ26879; |
| Gene ID | 11092 |
| mRNA Refseq | NM_018956 |
| Protein Refseq | NP_061829 |
| MIM | |
| UniProt ID | Q96E40 |
| Chromosome Location | 9q34.13 |
| ◆ Recombinant Proteins | ||
| C9orf9-191H | Recombinant Human C9orf9 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C9orf9-7920HCL | Recombinant Human C9orf9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf9 Products
Required fields are marked with *
My Review for All C9orf9 Products
Required fields are marked with *
