Recombinant Human CAGE1 protein, GST-tagged

Cat.No. : CAGE1-5733H
Product Overview : Recombinant Human CAGE1 protein, fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : KLDKYHSLNEELDFLVTSYEEIIECADQRLAISHSQIAHLEERNKHLEDLIRKPREKARKPRSKSLENHPKSMTMMPALFKENRNDLD
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name CAGE1 cancer antigen 1 [ Homo sapiens ]
Official Symbol CAGE1
Synonyms CAGE1; cancer antigen 1; cancer/testis antigen 3 , CTAG3; cancer-associated gene 1 protein; bA69L16.7; cancer/testis antigen 95; CT95; cancer/testis antigen 3; cancer/testis antigen gene 1; CT3; CTAG3; FLJ40441;
Gene ID 285782
mRNA Refseq NM_001170692
Protein Refseq NP_001164163
MIM 608304
UniProt ID Q8TC20

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAGE1 Products

Required fields are marked with *

My Review for All CAGE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon