Recombinant Human CAGE1 protein, GST-tagged
Cat.No. : | CAGE1-5733H |
Product Overview : | Recombinant Human CAGE1 protein, fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | KLDKYHSLNEELDFLVTSYEEIIECADQRLAISHSQIAHLEERNKHLEDLIRKPREKARKPRSKSLENHPKSMTMMPALFKENRNDLD |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CAGE1 cancer antigen 1 [ Homo sapiens ] |
Official Symbol | CAGE1 |
Synonyms | CAGE1; cancer antigen 1; cancer/testis antigen 3 , CTAG3; cancer-associated gene 1 protein; bA69L16.7; cancer/testis antigen 95; CT95; cancer/testis antigen 3; cancer/testis antigen gene 1; CT3; CTAG3; FLJ40441; |
Gene ID | 285782 |
mRNA Refseq | NM_001170692 |
Protein Refseq | NP_001164163 |
MIM | 608304 |
UniProt ID | Q8TC20 |
◆ Recombinant Proteins | ||
CAGE1-0285H | Recombinant Human CAGE1 Protein, GST-Tagged | +Inquiry |
CAGE1-1084R | Recombinant Rat CAGE1 Protein | +Inquiry |
CAGE1-5733H | Recombinant Human CAGE1 protein, GST-tagged | +Inquiry |
CAGE1-748R | Recombinant Rat CAGE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAGE1-1184M | Recombinant Mouse CAGE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAGE1 Products
Required fields are marked with *
My Review for All CAGE1 Products
Required fields are marked with *