Recombinant Human CAGE1 Protein, GST-Tagged

• Cat.No.: CAGE1-0285H
• Product Overview: Human CAGE1 partial ORF (NP_786887.1, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CAGE1 (Cancer Antigen 1) is a Protein Coding gene. Diseases associated with CAGE1 include Chronic Frontal Sinusitis and Rectal Neoplasm.
• Molecular Mass: 36.63 kDa
• AA Sequence: NKDYQKFWSSPSDPVHFEVDTSHEKVESMSESDTMNVSNLSQGVMLSHSPICMETTGTTCDLPQNEIKNFERENEYESTLCEDAYGTLDNLLNDNNIEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CAGE1 cancer antigen 1 [ Homo sapiens ]
• Official Symbol: CAGE1
• Synonyms: CAGE1; cancer antigen 1; cancer/testis antigen 3, CTAG3; cancer-associated gene 1 protein; bA69L16.7; cancer/testis antigen 95; CT95; cancer/testis antigen 3; cancer/testis antigen gene 1; CT3; CTAG3; FLJ40441
• Gene ID: 285782
• mRNA Refseq: NM_001170692
• Protein Refseq: NP_001164163
• MIM: 608304
• UniProt ID: Q8TC20