Recombinant Human CAGE1 Protein, GST-Tagged
Cat.No. : | CAGE1-0285H |
Product Overview : | Human CAGE1 partial ORF (NP_786887.1, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CAGE1 (Cancer Antigen 1) is a Protein Coding gene. Diseases associated with CAGE1 include Chronic Frontal Sinusitis and Rectal Neoplasm. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | NKDYQKFWSSPSDPVHFEVDTSHEKVESMSESDTMNVSNLSQGVMLSHSPICMETTGTTCDLPQNEIKNFERENEYESTLCEDAYGTLDNLLNDNNIEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAGE1 cancer antigen 1 [ Homo sapiens ] |
Official Symbol | CAGE1 |
Synonyms | CAGE1; cancer antigen 1; cancer/testis antigen 3, CTAG3; cancer-associated gene 1 protein; bA69L16.7; cancer/testis antigen 95; CT95; cancer/testis antigen 3; cancer/testis antigen gene 1; CT3; CTAG3; FLJ40441; |
Gene ID | 285782 |
mRNA Refseq | NM_001170692 |
Protein Refseq | NP_001164163 |
MIM | 608304 |
UniProt ID | Q8TC20 |
◆ Recombinant Proteins | ||
CAGE1-0285H | Recombinant Human CAGE1 Protein, GST-Tagged | +Inquiry |
CAGE1-1184M | Recombinant Mouse CAGE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAGE1-1084R | Recombinant Rat CAGE1 Protein | +Inquiry |
CAGE1-2640M | Recombinant Mouse CAGE1 Protein | +Inquiry |
CAGE1-748R | Recombinant Rat CAGE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAGE1 Products
Required fields are marked with *
My Review for All CAGE1 Products
Required fields are marked with *
0
Inquiry Basket