Recombinant Human CATSPER3 Protein, GST-Tagged
| Cat.No. : | CATSPER3-0447H | 
| Product Overview : | Human CATSPER3 partial ORF (NP_821138, 299 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CATSPER3 (Cation Channel Sperm Associated 3) is a Protein Coding gene. Among its related pathways are Fertilization. GO annotations related to this gene include ion channel activity and calcium activated cation channel activity. An important paralog of this gene is CATSPER2. | 
| Molecular Mass : | 36.74 kDa | 
| AA Sequence : | QRQQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQDTTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CATSPER3 cation channel, sperm associated 3 [ Homo sapiens ] | 
| Official Symbol | CATSPER3 | 
| Synonyms | CATSPER3; cation channel, sperm associated 3; cation channel sperm-associated protein 3; CACRC; ca(v)-like protein; putative ion channel CatSper3; calcium channel repeat containing 1; one-repeat calcium channel-like protein; MGC126741; | 
| Gene ID | 347732 | 
| mRNA Refseq | NM_178019 | 
| Protein Refseq | NP_821138 | 
| MIM | 609120 | 
| UniProt ID | Q86XQ3 | 
| ◆ Recombinant Proteins | ||
| CATSPER3-10747H | Recombinant Human CATSPER3, His-tagged | +Inquiry | 
| RFL24825HF | Recombinant Full Length Human Cation Channel Sperm-Associated Protein 3(Catsper3) Protein, His-Tagged | +Inquiry | 
| RFL14820MF | Recombinant Full Length Mouse Cation Channel Sperm-Associated Protein 3(Catsper3) Protein, His-Tagged | +Inquiry | 
| CATSPER3-0447H | Recombinant Human CATSPER3 Protein, GST-Tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CATSPER3 Products
Required fields are marked with *
My Review for All CATSPER3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            