Recombinant Human CAV3 protein, GST-tagged

Cat.No. : CAV3-18H
Product Overview : Recombinant Human CAV3(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-151 a.a.
Description : This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.7 kDa
AA Sequence : MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRL LSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKE V
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CAV3 caveolin 3 [ Homo sapiens ]
Official Symbol CAV3
Synonyms CAV3; caveolin 3; caveolin-3; LGMD1C; LQT9; M caveolin; VIP 21; VIP21; M-caveolin; VIP-21; MGC126100; MGC126101; MGC126129;
Gene ID 859
mRNA Refseq NM_001234
Protein Refseq NP_001225
MIM 601253
UniProt ID P56539
Chromosome Location 3p25
Pathway Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function nitric-oxide synthase binding; protein C-terminus binding; protein binding; protein complex binding; protein complex scaffold; sodium channel regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAV3 Products

Required fields are marked with *

My Review for All CAV3 Products

Required fields are marked with *

0
cart-icon
0
compare icon