Recombinant Human CAV3 protein, Myc/DDK-tagged
Cat.No. : | CAV3-011H |
Product Overview : | Recombinant Human CAV3 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Druggable Genome, Transmembrane. Protein Pathways: Focal adhesion. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC409590 TA350952 RC221140 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name | CAV3 caveolin 3 [ Homo sapiens (human) ] |
Official Symbol | CAV3 |
Synonyms | LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21 |
Gene ID | 859 |
mRNA Refseq | NM_033337 |
Protein Refseq | NP_203123 |
MIM | 601253 |
UniProt ID | P56539 |
◆ Recombinant Proteins | ||
CAV3-511H | Recombinant Human CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-011H | Recombinant Human CAV3 protein, Myc/DDK-tagged | +Inquiry |
CAV3-2775M | Recombinant Mouse CAV3 Protein | +Inquiry |
CAV3-92H | Recombinant Human caveolin 3 | +Inquiry |
Cav3-782M | Recombinant Mouse Cav3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAV3 Products
Required fields are marked with *
My Review for All CAV3 Products
Required fields are marked with *