Recombinant Human CAV3 protein, Myc/DDK-tagged

• Cat.No.: CAV3-011H
• Product Overview: Recombinant Human CAV3 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Druggable Genome, Transmembrane. Protein Pathways: Focal adhesion.

Specification

• Description: This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.
• Source: HEK293T
• Species: Human
• Tag: Myc/DDK
• Form: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 17.1 kDa
• AA Sequence: myc-FLAG tag
• Product-Related Proteins: TA50011-100
  LC409590
  TA350952
  RC221140
• Purity: > 80%
• Usage: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL

Gene Information

• Gene Name: CAV3 caveolin 3 [ Homo sapiens (human) ]
• Official Symbol: CAV3
• Synonyms: LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21
• Gene ID: 859
• mRNA Refseq: NM_033337
• Protein Refseq: NP_203123
• MIM: 601253
• UniProt ID: P56539