Recombinant Human CAV3 protein, Myc/DDK-tagged

Cat.No. : CAV3-011H
Product Overview : Recombinant Human CAV3 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Druggable Genome, Transmembrane. Protein Pathways: Focal adhesion.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.
Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.1 kDa
AA Sequence : myc-FLAG tag
Product-Related Proteins : TA50011-100
LC409590
TA350952
RC221140
Purity : > 80%
Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL
Gene Name CAV3 caveolin 3 [ Homo sapiens (human) ]
Official Symbol CAV3
Synonyms LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21
Gene ID 859
mRNA Refseq NM_033337
Protein Refseq NP_203123
MIM 601253
UniProt ID P56539

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAV3 Products

Required fields are marked with *

My Review for All CAV3 Products

Required fields are marked with *

0
cart-icon