Recombinant Human CC2D1A, His-tagged
Cat.No. : | CC2D1A-26320TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 672-951 of Human CC2D1A with N terminal His tag; Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 672-951 a.a. |
Description : | This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 106 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFK EQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDR VLGTAQLKLDALEIACEVREILEVLDGRRPTGGRLEVM VRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKG KAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRR EYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNL VESELQRLRR |
Gene Name | CC2D1A coiled-coil and C2 domain containing 1A [ Homo sapiens ] |
Official Symbol | CC2D1A |
Synonyms | CC2D1A; coiled-coil and C2 domain containing 1A; coiled-coil and C2 domain-containing protein 1A; FLJ20241; mental retardation; nonsyndromic; autosomal recessive; 3; MRT3; |
Gene ID | 54862 |
mRNA Refseq | NM_017721 |
Protein Refseq | NP_060191 |
MIM | 610055 |
Uniprot ID | Q6P1N0 |
Chromosome Location | 19p13.12 |
Pathway | SIDS Susceptibility Pathways, organism-specific biosystem; |
Function | DNA binding; signal transducer activity; |
◆ Recombinant Proteins | ||
CC2D1A-26320TH | Recombinant Human CC2D1A, His-tagged | +Inquiry |
CC2D1A-636H | Recombinant Human CC2D1A Protein, His-tagged | +Inquiry |
CC2D1A-2799M | Recombinant Mouse CC2D1A Protein | +Inquiry |
CC2D1A-0489H | Recombinant Human CC2D1A Protein, GST-Tagged | +Inquiry |
CC2D1A-822R | Recombinant Rat CC2D1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CC2D1A-7799HCL | Recombinant Human CC2D1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CC2D1A Products
Required fields are marked with *
My Review for All CC2D1A Products
Required fields are marked with *
0
Inquiry Basket