Recombinant Human CC2D1A, His-tagged
| Cat.No. : | CC2D1A-26320TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 672-951 of Human CC2D1A with N terminal His tag; Predicted MWt 33 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 672-951 a.a. | 
| Description : | This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 106 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | GLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFK EQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDR VLGTAQLKLDALEIACEVREILEVLDGRRPTGGRLEVM VRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKG KAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRR EYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNL VESELQRLRR | 
| Gene Name | CC2D1A coiled-coil and C2 domain containing 1A [ Homo sapiens ] | 
| Official Symbol | CC2D1A | 
| Synonyms | CC2D1A; coiled-coil and C2 domain containing 1A; coiled-coil and C2 domain-containing protein 1A; FLJ20241; mental retardation; nonsyndromic; autosomal recessive; 3; MRT3; | 
| Gene ID | 54862 | 
| mRNA Refseq | NM_017721 | 
| Protein Refseq | NP_060191 | 
| MIM | 610055 | 
| Uniprot ID | Q6P1N0 | 
| Chromosome Location | 19p13.12 | 
| Pathway | SIDS Susceptibility Pathways, organism-specific biosystem; | 
| Function | DNA binding; signal transducer activity; | 
| ◆ Recombinant Proteins | ||
| CC2D1A-2789HF | Recombinant Full Length Human CC2D1A Protein, GST-tagged | +Inquiry | 
| Cc2d1a-1979M | Recombinant Mouse Cc2d1a Protein, Myc/DDK-tagged | +Inquiry | 
| CC2D1A-636H | Recombinant Human CC2D1A Protein, His-tagged | +Inquiry | 
| CC2D1A-1164R | Recombinant Rat CC2D1A Protein | +Inquiry | 
| CC2D1A-10775H | Recombinant Human CC2D1A, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CC2D1A-7799HCL | Recombinant Human CC2D1A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CC2D1A Products
Required fields are marked with *
My Review for All CC2D1A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            