Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged
Cat.No. : | CEBPA-94H |
Product Overview : | Recombinant HumanCEBP-α (residues 270-358) was purified by ion-exchange chromatography and FPLC gel-filtration chromatography. Recombinant Human CEBP-α His-Tag fusion proein produced in E.Coli is a single, non-glycosylated polypeptide chain containing amino acids 126 and having a molecular mass of 14.5 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 270-358 a.a. |
Description : | CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBP α die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBP β causes defects in female reproduction. |
Amino Acid Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS RELDTLRGIF RQLPESSLVKAMGNCA |
Physical Appearance : | Sterile filtered clorless solution. |
Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by reducing and non-reducing SDS-PAGE Coomassie |
Formulation : | The protein (0.87mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol |
Applications : | • ELISA • Inhibition Assays• Western Blotting |
Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
Gene Name | CEBPA CCAAT/enhancer binding protein (C/EBP), alpha [ Homo sapiens ] |
Synonyms | CEBPA; C/EBP-alpha; CEBP; CCAAT/enhancer binding protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha |
Gene ID | 1050 |
mRNA Refseq | NM_004364 |
Protein Refseq | NP_004355 |
MIM | 601626 |
UniProt ID | P49715 |
Chromosome Location | 19q13.1 |
Pathway | Acute myeloid leukemia; Pathways in cancer |
Function | RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; sequence-specific DNA binding; transcription factor binding |
◆ Recombinant Proteins | ||
CEBPA-982R | Recombinant Rat CEBPA Protein, His (Fc)-Avi-tagged | +Inquiry |
CEBPA-5377H | Recombinant Human CCAAT/Enhancer Binding Protein (C/EBP), Alpha, His-tagged | +Inquiry |
CEBPA-9389Z | Recombinant Zebrafish CEBPA | +Inquiry |
CEBPA-73H | Recombinant Human CCAAT/enhancer binding protein Alpha, His-tagged | +Inquiry |
CEBPA-3259M | Recombinant Mouse CEBPA Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPA Products
Required fields are marked with *
My Review for All CEBPA Products
Required fields are marked with *