Recombinant Human CCDC169 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CCDC169-4635H
Product Overview : C13orf38 MS Standard C13 and N15-labeled recombinant protein (NP_001138453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CCDC169 (Coiled-Coil Domain Containing 169) is a Protein Coding gene.
Molecular Mass : 25.1 kDa
AA Sequence : MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPVKKITRPNHLPELHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CCDC169 coiled-coil domain containing 169 [ Homo sapiens (human) ]
Official Symbol CCDC169
Synonyms CCDC169; coiled-coil domain containing 169; C13orf38, chromosome 13 open reading frame 38; coiled-coil domain-containing protein 169; LOC728591; RP11 251J8.1; RP11-251J8.1; C13orf38; FLJ13506; FLJ29024; FLJ57222;
Gene ID 728591
mRNA Refseq NM_001144981
Protein Refseq NP_001138453
UniProt ID A6NNP5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC169 Products

Required fields are marked with *

My Review for All CCDC169 Products

Required fields are marked with *

0
cart-icon