Recombinant Human CCDC169 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CCDC169-4635H |
Product Overview : | C13orf38 MS Standard C13 and N15-labeled recombinant protein (NP_001138453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CCDC169 (Coiled-Coil Domain Containing 169) is a Protein Coding gene. |
Molecular Mass : | 25.1 kDa |
AA Sequence : | MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPVKKITRPNHLPELHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CCDC169 coiled-coil domain containing 169 [ Homo sapiens (human) ] |
Official Symbol | CCDC169 |
Synonyms | CCDC169; coiled-coil domain containing 169; C13orf38, chromosome 13 open reading frame 38; coiled-coil domain-containing protein 169; LOC728591; RP11 251J8.1; RP11-251J8.1; C13orf38; FLJ13506; FLJ29024; FLJ57222; |
Gene ID | 728591 |
mRNA Refseq | NM_001144981 |
Protein Refseq | NP_001138453 |
UniProt ID | A6NNP5 |
◆ Recombinant Proteins | ||
CCDC169-4635H | Recombinant Human CCDC169 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC169-1324M | Recombinant Mouse CCDC169 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC169-2763H | Recombinant Human CCDC169 Protein, MYC/DDK-tagged | +Inquiry |
CCDC169-2865M | Recombinant Mouse CCDC169 Protein | +Inquiry |
Ccdc169-1997M | Recombinant Mouse Ccdc169 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC169 Products
Required fields are marked with *
My Review for All CCDC169 Products
Required fields are marked with *
0
Inquiry Basket