Recombinant Human CCDC28B Protein, GST-Tagged
| Cat.No. : | CCDC28B-0543H |
| Product Overview : | Human CCDC28B full-length ORF (NP_077272.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Molecular Mass : | 48.4 kDa |
| AA Sequence : | MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC28B coiled-coil domain containing 28B [ Homo sapiens ] |
| Official Symbol | CCDC28B |
| Synonyms | CCDC28B; coiled-coil domain containing 28B; coiled-coil domain-containing protein 28B; MGC1203; RP4 622L5.5; RP4-622L5.5; MGC16441; |
| Gene ID | 79140 |
| mRNA Refseq | NM_024296 |
| Protein Refseq | NP_077272 |
| MIM | 610162 |
| UniProt ID | Q9BUN5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC28B Products
Required fields are marked with *
My Review for All CCDC28B Products
Required fields are marked with *



