Cat.No.:	CCK-0602H
Product Overview:	Human CCK full-length ORF (AAH08283, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	38.39 kDa
AA Sequence:	MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name:	CCK cholecystokinin [ Homo sapiens ]
Official Symbol:	CCK
Synonyms:	CCK; cholecystokinin; MGC117187;
Gene ID:	885
mRNA Refseq:	NM_000729
Protein Refseq:	NP_000720
MIM:	118440
UniProt ID:	P06307

Online Inquiry