"CCK" Related Products

Expand
Expand
Expand

Recombinant Human CCK Protein, GST-Tagged

Cat.No.: CCK-0602H
Product Overview: Human CCK full-length ORF (AAH08283, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 38.39 kDa
AA Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CCK cholecystokinin [ Homo sapiens ]
Official Symbol: CCK
Synonyms: CCK; cholecystokinin; MGC117187;
Gene ID: 885
mRNA Refseq: NM_000729
Protein Refseq: NP_000720
MIM: 118440
UniProt ID: P06307

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.