"CD24" Related Products

Expand
Expand
Expand

Recombinant Human CD24 Protein, GST-Tagged

Cat.No.: CD24-0751H
Product Overview: Human CD24 full-length ORF (AAH07674, 28 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 31.57 kDa
AA Sequence: ETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CD24 CD24 molecule [ Homo sapiens ]
Official Symbol: CD24
Synonyms: CD24; CD24 molecule; CD24 antigen (small cell lung carcinoma cluster 4 antigen); signal transducer CD24; CD24A; FLJ22950; FLJ43543; MGC75043;
Gene ID: 100133941
mRNA Refseq: NM_013230
Protein Refseq: NP_037362
MIM: 600074
UniProt ID: P25063

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.