Recombinant Human CD320 Protein, C-His-tagged
Cat.No. : | CD320-238H |
Product Overview : | Recombinant Human CD320 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The 8D6 protein, also known as 8D6A, CD320 or FDC-SM-8D6, is a single pass, type I membrane protein with two low-density lipoprotein receptor ligand binding repeats (LDL-A modules). It is expressed by follicular dendritic cells in the germinal center and acts as a stimulatory signaling molecule. Follicular dendritic cells and T cells interact with germinal center B cells, providing signals for survival, proliferation and differentiation into memory B cells and plasma cells. A disruption of this interaction results in apoptosis of B cells. 8D6 is a growth factor required for plasma cell generation from germinal center B cells. Protein 8D6, together with HCAM (or CD44), plays a significant role in the proliferation of lymphoma cells of germinal center origin. 8D6 is responsible for enhancing proliferation while HCAM inhibits apoptosis. |
Molecular Mass : | ~21 kDa |
AA Sequence : | SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD320 CD320 molecule [ Homo sapiens (human) ] |
Official Symbol | CD320 |
Synonyms | CD320; CD320 molecule; 8D6; 8D6A; TCBLR; TCN2R; TCII-R; sCD320; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; soluble CD320; transcobalamin 2 receptor; transcobalamin receptor |
Gene ID | 51293 |
mRNA Refseq | NM_016579 |
Protein Refseq | NP_057663 |
MIM | 606475 |
UniProt ID | Q9NPF0 |
◆ Recombinant Proteins | ||
Cd320-320R | Recombinant Rat Cd320 protein(Met1-Ala210), hFc-tagged | +Inquiry |
CD320-905R | Recombinant Rat CD320 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD320-01H | Recombinant Human CD320 Protein, hIgG-His-Tagged | +Inquiry |
CD320-12H | Recombinant Human CD320 Protein, C-Fc-tagged | +Inquiry |
CD320-1730R | Recombinant Rhesus Monkey CD320 Protein, hIgG4-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD320-001MCL | Recombinant Mouse CD320 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD320 Products
Required fields are marked with *
My Review for All CD320 Products
Required fields are marked with *
0
Inquiry Basket