Recombinant Human CD7 Protein, GST-Tagged
| Cat.No. : | CD7-0847H |
| Product Overview : | Human CD7 full-length ORF (AAH09293, 21 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 49.94 kDa |
| AA Sequence : | PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD7 CD7 molecule [ Homo sapiens ] |
| Official Symbol | CD7 |
| Synonyms | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9; |
| Gene ID | 924 |
| mRNA Refseq | NM_006137 |
| Protein Refseq | NP_006128 |
| MIM | 186820 |
| UniProt ID | P09564 |
| ◆ Recombinant Proteins | ||
| CD7-222HB | Recombinant Human CD7 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CD7-032H | Recombinant Human CD7 protein, His-Avi-tagged | +Inquiry |
| CD7-2337M | Recombinant Mouse CD7 protein(Met1-Pro150), hFc-tagged | +Inquiry |
| CD7-3007H | Active Recombinant Human CD7 protein, Fc-tagged | +Inquiry |
| CD7-1452H | Recombinant Human CD7 Protein (Ala26-Pro180), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
| CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
| CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *



