"CDA" Related Products

Expand
Expand

Recombinant Human CDA protein, T7/His-tagged

Cat.No.: CDA-206H
Product Overview: Recombinant human CDA cDNA (145 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQEG RIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDG TYIVMTVQELLPSSFGPEDLQKTQ
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: CDA cytidine deaminase [ Homo sapiens ]
Official Symbol: CDA
Synonyms: CDA; cytidine deaminase; CDD; cytidine aminohydrolase; small cytidine deaminase; cytosine nucleoside deaminase;
Gene ID: 978
mRNA Refseq: NM_001785
Protein Refseq: NP_001776
MIM: 123920
UniProt ID: P32320
Chromosome Location: 1p36.2-p35
Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem;
Function: cytidine deaminase activity; cytidine deaminase activity; hydrolase activity; metal ion binding; nucleoside binding; protein homodimerization activity; zinc ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.