Recombinant Human CDC26 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDC26-4328H |
Product Overview : | CDC26 MS Standard C13 and N15-labeled recombinant protein (NP_644815) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. |
Molecular Mass : | 9.8 kDa |
AA Sequence : | MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDC26 cell division cycle 26 [ Homo sapiens (human) ] |
Official Symbol | CDC26 |
Synonyms | CDC26; cell division cycle 26 homolog (S. cerevisiae); C9orf17, cell division cycle 26, chromosome 9 open reading frame 17; anaphase-promoting complex subunit CDC26; ANAPC12; anaphase promoting complex subunit 12; APC12; CDC26 subunit of anaphase promoting complex; anaphase-promoting complex subunit 12; cell division cycle protein 26 homolog; C9orf17; |
Gene ID | 246184 |
mRNA Refseq | NM_139286 |
Protein Refseq | NP_644815 |
MIM | 614533 |
UniProt ID | Q8NHZ8 |
◆ Recombinant Proteins | ||
CDC26-760R | Recombinant Rhesus monkey CDC26 Protein, His-tagged | +Inquiry |
CDC26-1203Z | Recombinant Zebrafish CDC26 | +Inquiry |
CDC26-3554H | Recombinant Human CDC26, His-tagged | +Inquiry |
CDC26-1273R | Recombinant Rat CDC26 Protein | +Inquiry |
CDC26-931R | Recombinant Rat CDC26 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC26-7663HCL | Recombinant Human CDC26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC26 Products
Required fields are marked with *
My Review for All CDC26 Products
Required fields are marked with *