"CDK4" Related Products

Expand
Expand

Recombinant Human CDK4 protein, T7-tagged

Cat.No.: CDK4-191H
Product Overview: Recombinant human CDK4 (303 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC IVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRIS AFRALQHSYLHKDEGNPE
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: CDK4 cyclin-dependent kinase 4 [ Homo sapiens ]
Official Symbol: CDK4
Synonyms: CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458;
Gene ID: 1019
mRNA Refseq: NM_000075
Protein Refseq: NP_000066
MIM: 123829
UniProt ID: P11802
Chromosome Location: 12q13
Pathway: ATF-2 transcription factor network, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.