Recombinant Human CDK4 protein, T7-tagged

Species :	Human
Source :	E.coli
Tag :	T7
Protein Length :	303 a.a.
Form :	0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence :	MASMTGGQQMGRGEFMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC IVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRIS AFRALQHSYLHKDEGNPE
Purity :	>90% by SDS-PAGE.
Storage :	Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Name	CDK4 cyclin-dependent kinase 4 [ Homo sapiens ]
Official Symbol	CDK4
Synonyms	CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458;
Gene ID	1019
mRNA Refseq	NM_000075
Protein Refseq	NP_000066
MIM	123829
UniProt ID	P11802
Chromosome Location	12q13
Pathway	ATF-2 transcription factor network, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function	ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity;