Recombinant Human CDK4 protein, His-tagged
| Cat.No. : | CDK4-2208H |
| Product Overview : | Recombinant Human CDK4 protein(P11802)(2-303aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 2-303aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.6 kDa |
| AA Sequence : | ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CDK4 cyclin-dependent kinase 4 [ Homo sapiens ] |
| Official Symbol | CDK4 |
| Synonyms | CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458; |
| Gene ID | 1019 |
| mRNA Refseq | NM_000075 |
| Protein Refseq | NP_000066 |
| MIM | 123829 |
| UniProt ID | P11802 |
| ◆ Recombinant Proteins | ||
| CDK4-1304R | Recombinant Rat CDK4 Protein | +Inquiry |
| CDK4-610R | Recombinant Rhesus Macaque CDK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDK4-16H | Recombinant Human CDK4, His-tagged | +Inquiry |
| CDK4-3183HF | Recombinant Full Length Human CDK4 Protein, GST-tagged | +Inquiry |
| CDK4/CCND3-275H | Recombinant Human CDK4/CCND3, GST-tagged, Active | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK4-664HCL | Recombinant Human CDK4 cell lysate | +Inquiry |
| CDK4-477HKCL | Human CDK4 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK4 Products
Required fields are marked with *
My Review for All CDK4 Products
Required fields are marked with *
