Recombinant Human CELSR3 Protein, GST-Tagged

Cat.No. : CELSR3-1110H
Product Overview : Human CELSR3 partial ORF (NP_001398, 71 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the flamingo subfamily, which is included in the cadherin superfamily. The flamingo cadherins consist of nonclassic-type cadherins that do not interact with catenins. They are plasma membrane proteins containing seven epidermal growth factor-like repeats, nine cadherin domains and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic feature of their subfamily. The encoded protein may be involved in the regulation of contact-dependent neurite growth and may play a role in tumor formation. [provided by RefSeq, Jun 2013]
Molecular Mass : 37.84 kDa
AA Sequence : REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CELSR3 cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila) [ Homo sapiens ]
Official Symbol CELSR3
Synonyms CELSR3; cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila); cadherin EGF LAG seven pass G type receptor 3, flamingo (Drosophila) homolog, EGFL1; cadherin EGF LAG seven-pass G-type receptor 3; CDHF11; FMI1; HFMI1; MEGF2; anchor protein; EGF-like protein 1; flamingo homolog 1; cadherin family member 11; EGF-like-domain, multiple 1; multiple EGF-like domains 2; epidermal growth factor-like 1; multiple EGF-like domains protein 2; epidermal growth factor-like protein 1; multiple epidermal growth factor-like domains protein 2; EGFL1; RESDA1;
Gene ID 1951
mRNA Refseq NM_001407
Protein Refseq NP_001398
MIM 604264
UniProt ID Q9NYQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELSR3 Products

Required fields are marked with *

My Review for All CELSR3 Products

Required fields are marked with *

0
cart-icon
0
compare icon