Recombinant Human CELSR3 Protein, GST-Tagged

• Cat.No.: CELSR3-1110H
• Product Overview: Human CELSR3 partial ORF (NP_001398, 71 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the flamingo subfamily, which is included in the cadherin superfamily. The flamingo cadherins consist of nonclassic-type cadherins that do not interact with catenins. They are plasma membrane proteins containing seven epidermal growth factor-like repeats, nine cadherin domains and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic feature of their subfamily. The encoded protein may be involved in the regulation of contact-dependent neurite growth and may play a role in tumor formation. [provided by RefSeq, Jun 2013]
• Molecular Mass: 37.84 kDa
• AA Sequence: REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CELSR3 cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila) [ Homo sapiens ]
• Official Symbol: CELSR3
• Synonyms: CELSR3; cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila); cadherin EGF LAG seven pass G type receptor 3, flamingo (Drosophila) homolog, EGFL1; cadherin EGF LAG seven-pass G-type receptor 3; CDHF11; FMI1; HFMI1; MEGF2; anchor protein; EGF-like protein 1; flamingo homolog 1; cadherin family member 11; EGF-like-domain, multiple 1; multiple EGF-like domains 2; epidermal growth factor-like 1; multiple EGF-like domains protein 2; epidermal growth factor-like protein 1; multiple epidermal growth factor-like domains protein 2; EGFL1; RESDA1
• Gene ID: 1951
• mRNA Refseq: NM_001407
• Protein Refseq: NP_001398
• MIM: 604264
• UniProt ID: Q9NYQ7