Recombinant Human CENPA protein, GST-tagged
| Cat.No. : | CENPA-301526H | 
| Product Overview : | Recombinant Human CENPA protein(1-59 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-59 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
| AASequence : | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | CENPA centromere protein A [ Homo sapiens ] | 
| Official Symbol | CENPA | 
| Synonyms | CENPA; centromere protein A; centromere protein A (17kD) , centromere protein A, 17kDa; histone H3-like centromeric protein A; CenH3; CENP A; centromere specific histone; histone H3 like centromeric protein A; centromere autoantigen A; centromere protein A, 17kDa; centromere-specific histone; CENP-A; | 
| Gene ID | 1058 | 
| mRNA Refseq | NM_001042426 | 
| Protein Refseq | NP_001035891 | 
| MIM | 117139 | 
| UniProt ID | P49450 | 
| ◆ Recombinant Proteins | ||
| CENPA-301526H | Recombinant Human CENPA protein, GST-tagged | +Inquiry | 
| CENPA-1359M | Recombinant Mouse CELA2A Protein (1-134 aa), His-tagged | +Inquiry | 
| CENPA-575H | Recombinant Human CENPA Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CENPA-3281M | Recombinant Mouse CENPA Protein | +Inquiry | 
| CENPA-27391TH | Recombinant Human CENPA, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry | 
| CENPA-7587HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPA Products
Required fields are marked with *
My Review for All CENPA Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            