Recombinant Human CENPA protein, GST-tagged
| Cat.No. : | CENPA-301526H |
| Product Overview : | Recombinant Human CENPA protein(1-59 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-59 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CENPA centromere protein A [ Homo sapiens ] |
| Official Symbol | CENPA |
| Synonyms | CENPA; centromere protein A; centromere protein A (17kD) , centromere protein A, 17kDa; histone H3-like centromeric protein A; CenH3; CENP A; centromere specific histone; histone H3 like centromeric protein A; centromere autoantigen A; centromere protein A, 17kDa; centromere-specific histone; CENP-A; |
| Gene ID | 1058 |
| mRNA Refseq | NM_001042426 |
| Protein Refseq | NP_001035891 |
| MIM | 117139 |
| UniProt ID | P49450 |
| ◆ Recombinant Proteins | ||
| CENPA-3735C | Recombinant Chicken CENPA | +Inquiry |
| CENPA-1111H | Recombinant Human CENPA Protein, GST-Tagged | +Inquiry |
| CENPA-1359M | Recombinant Mouse CELA2A Protein (1-134 aa), His-tagged | +Inquiry |
| CENPA-6623H | Recombinant Human CENPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CENPA-3313HF | Recombinant Full Length Human CENPA Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
| CENPA-7587HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPA Products
Required fields are marked with *
My Review for All CENPA Products
Required fields are marked with *



