Recombinant Full Length Human CENPA Protein, GST-tagged
| Cat.No. : | CENPA-3313HF |
| Product Overview : | Human CENPA full-length ORF (AAH00881, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 114 amino acids |
| Description : | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 38.28 kDa |
| AA Sequence : | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CENPA centromere protein A [ Homo sapiens ] |
| Official Symbol | CENPA |
| Synonyms | CENPA; centromere protein A; centromere protein A (17kD), centromere protein A, 17kDa; histone H3-like centromeric protein A; CenH3; CENP A; centromere specific histone; histone H3 like centromeric protein A; centromere autoantigen A; centromere protein A, 17kDa; centromere-specific histone; CENP-A; |
| Gene ID | 1058 |
| mRNA Refseq | NM_001042426 |
| Protein Refseq | NP_001035891 |
| MIM | 117139 |
| UniProt ID | P49450 |
| ◆ Recombinant Proteins | ||
| CENPA-575H | Recombinant Human CENPA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CENPA-617H | Recombinant Human Centromere Protein A, His-tagged | +Inquiry |
| CENPA-1111H | Recombinant Human CENPA Protein, GST-Tagged | +Inquiry |
| CENPA-572HFL | Recombinant Full Length Human CENPA Protein, C-Flag-tagged | +Inquiry |
| CENPA-1359M | Recombinant Mouse CELA2A Protein (1-134 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
| CENPA-7587HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPA Products
Required fields are marked with *
My Review for All CENPA Products
Required fields are marked with *
