Recombinant Full Length Human CENPA Protein, GST-tagged

• Cat.No.: CENPA-3313HF
• Product Overview: Human CENPA full-length ORF (AAH00881, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 114 amino acids
• Description: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]
• Molecular Mass: 38.28 kDa
• AA Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CENPA centromere protein A [ Homo sapiens ]
• Official Symbol: CENPA
• Synonyms: CENPA; centromere protein A; centromere protein A (17kD), centromere protein A, 17kDa; histone H3-like centromeric protein A; CenH3; CENP A; centromere specific histone; histone H3 like centromeric protein A; centromere autoantigen A; centromere protein A, 17kDa; centromere-specific histone; CENP-A
• Gene ID: 1058
• mRNA Refseq: NM_001042426
• Protein Refseq: NP_001035891
• MIM: 117139
• UniProt ID: P49450